PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021320-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 478aa    MW: 50989.7 Da    PI: 6.1913
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021320-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-172673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l+++vk++G g+W+++ +  g+ R++k+c++rw ++l
    NNU_021320-RA 26 KGPWTAAEDAILIEYVKKHGEGNWNAVQKNSGLSRCGKSCRLRWANHL 73
                     79******************************************9986 PP

2Myb_DNA-binding49.21.2e-1579122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+ l+++++ +lG++ W++ a+ ++ gRt++++k++w++
    NNU_021320-RA  79 KGSFSPEEERLILELHSKLGNK-WARMAAQLP-GRTDNEIKNYWNT 122
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9572173IPR017930Myb domain
SuperFamilySSF466894.03E-3123120IPR009057Homeodomain-like
SMARTSM007173.7E-162575IPR001005SANT/Myb domain
PfamPF002497.0E-162673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-242780IPR009057Homeodomain-like
CDDcd001672.43E-122873No hitNo description
PROSITE profilePS5129425.47774128IPR017930Myb domain
SMARTSM007175.7E-1678126IPR001005SANT/Myb domain
PfamPF002496.4E-1579122IPR001005SANT/Myb domain
CDDcd001671.60E-1181122No hitNo description
Gene3DG3DSA:1.10.10.604.4E-2581127IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MTPNNGAAAT SDDASTGGGA GGGLKKGPWT AAEDAILIEY VKKHGEGNWN AVQKNSGLSR  60
CGKSCRLRWA NHLRPNLKKG SFSPEEERLI LELHSKLGNK WARMAAQLPG RTDNEIKNYW  120
NTRVKRRQRA GLPLYPQDIQ KQATAYHHLN HQHQPQPRSS PSPSPQAQQP KPNYGSPLSL  180
FDSVSFPMTT PILGQHSASF LPDPLHRFKR LRDNNGVGVS IPFPSPPPQP PSSLFSQSLS  240
TQLQPIPSIQ FNSSNFELNP PPILQAPFDP DGIVPPGSAF SMKMELPSSQ LPQPAASAAA  300
SGATNGYKVG ALVGSNSGLL DALLQEAQAT AGVEDSSREG LSEDKCGLNG LVGDALPSGS  360
LFSEGATTPP LVSVSPWEES STGHSSIGVK AKRERIDEIN SVVDDDLSGL LDIIPSTMSV  420
PEWYSDSGEI SNGQSSGVTD DEIGLEMQHL ASSLSAATTT DHEWTHGSCS WNNMAGIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-33241275107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010278658.10.0PREDICTED: uncharacterized protein LOC104612781
TrEMBLF6HEP41e-133F6HEP4_VITVI; Putative uncharacterized protein
STRINGVIT_19s0090g00590.t011e-133(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.23e-72myb domain protein 101